3POZ - chain A | Epidermal growth factor receptor
Structure information
PDB: | 3POZ |
PubMed: | 21454582 |
Release date: | 2011-03-30 |
Resolution: | 1.5 Å |
Kinase: | EGFR |
Family: | EGFR |
Group: | TK |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No (14.6Å) |
ASP rotation (xDFG.81) : | 346° |
PHE rotation (xDFG.82) : | 328° |
Activation loop position: | -4.8Å |
αC-helix position: | 21Å |
G-rich loop angle: | 53.4° |
G-rich loop distance: | 16.8Å |
G-rich loop rotation: | 31.1° |
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I3
H-bond ligand
H-bond protein
I6
H-bond ligand
Binding pocket sequence
Uniprot | KVLGSGAFGTVYKVAIKELEILDEAYVMASVDPHVCRLLGIQLITQLMPFGCLLDYVREYLEDRRLVHRDLAARNVLVITDFGLA |
Structure: | KVLGSGAFGTVYKVAIKELEILDEAYVMASVDPHVCRLLGIQLITQLMPFGCLLDYVREYLEDRRLVHRDLAARNVLVITDFGLA |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: 03P
Ligand Name: N-{2-[4-({3-chloro-4-[3-(trifluoromethyl)phenoxy]phenyl}amino)-5H-pyrrolo[3,2-d]pyrimidin-5-yl]ethyl}-3-hydroxy-3-methylbutanamide
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 K 716 | 2 V 717 | 3 L 718 | 4 G 719 | 5 S 720 | 6 G 721 | 7 A 722 | 8 F 723 | 9 G 724 | 10 T 725 | 11 V 726 | 12 Y 727 | 13 K 728 | 14 V 742 | 15 A 743 | 16 I 744 | 17 K 745 | 18 E 746 | 19 L 747 | 20 E 758 |
■ | ■ | ■ | ■ | ■ | |||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 I 759 | 22 L 760 | 23 D 761 | 24 E 762 | 25 A 763 | 26 Y 764 | 27 V 765 | 28 M 766 | 29 A 767 | 30 S 768 | 31 V 769 | 32 D 770 | 33 P 772 | 34 H 773 | 35 V 774 | 36 C 775 | 37 R 776 | 38 L 777 | 39 L 778 | 40 G 779 |
■ | ■ | ■ | ■ | ||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 I 780 | 42 Q 787 | 43 L 788 | 44 I 789 | 45 T 790 | 46 Q 791 | 47 L 792 | 48 M 793 | 49 P 794 | 50 F 795 | 51 G 796 | 52 C 797 | 53 L 798 | 54 L 799 | 55 D 800 | 56 Y 801 | 57 V 802 | 58 R 803 | 59 E 804 | 60 Y 827 |
■ | ■ | ■ | ■ | ■▲ | ■ | ||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 828 | 62 E 829 | 63 D 830 | 64 R 831 | 65 R 832 | 66 L 833 | 67 V 834 | 68 H 835 | 69 R 836 | 70 D 837 | 71 L 838 | 72 A 839 | 73 A 840 | 74 R 841 | 75 N 842 | 76 V 843 | 77 L 844 | 78 V 845 | 79 I 853 | 80 T 854 |
■ | ■ | ■ | |||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 855 | 82 F 856 | 83 G 857 | 84 L 858 | 85 A 859 | |||||||||||||||
■ | ■ | ■ |
Binding affinities
ChEMBL ID:CHEMBL1614725Bioaffinities: 20 records for 13 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | Bone morphogenetic protein receptor type-1B | 5.8 | 5.8 | 5.8 | pKd | 1 |
Homo sapiens | Dual specificity mitogen-activated protein kinase kinase 1 | 6 | 6 | 6 | pIC50 | 1 |
Homo sapiens | Dual specificity mitogen-activated protein kinase kinase 5 | 5.2 | 5.2 | 5.2 | pIC50 | 1 |
Homo sapiens | Ephrin type-B receptor 6 | 5.7 | 5.7 | 5.7 | pKd | 1 |
Homo sapiens | Epidermal growth factor receptor erbB1 | 7.6 | 5.1 | 9 | pIC50 | 4 |
Homo sapiens | Epidermal growth factor receptor erbB1 | 6.2 | 6.2 | 6.2 | pKd | 1 |
Homo sapiens | Hepatocyte growth factor receptor | 5.4 | 5.4 | 5.4 | pIC50 | 1 |
Homo sapiens | Receptor protein-tyrosine kinase erbB-2 | 7.8 | 7.8 | 8.5 | pIC50 | 4 |
Homo sapiens | Receptor protein-tyrosine kinase erbB-4 | 6.6 | 6.6 | 6.6 | pIC50 | 1 |
Homo sapiens | Serine/threonine-protein kinase Aurora-B | 5.8 | 5.8 | 5.8 | pIC50 | 1 |
Homo sapiens | Serine/threonine protein kinase NLK | 6.1 | 6.1 | 6.1 | pKd | 1 |
Homo sapiens | Tyrosine-protein kinase CSK | 5.3 | 5.3 | 5.3 | pIC50 | 1 |
Homo sapiens | Tyrosine-protein kinase LCK | 5.6 | 5.6 | 5.6 | pIC50 | 1 |
Homo sapiens | Tyrosine-protein kinase Lyn | 5.3 | 5.3 | 5.3 | pIC50 | 1 |