5NXC - chain L | LIM domain kinase 1
Structure information
| PDB: | 5NXC |
| PubMed: | - |
| Release date: | 2017-05-24 |
| Resolution: | 2.25 Å |
| Kinase: | LIMK1 |
| Family: | LISK |
| Group: | TKL |
| Species: | HUMAN |
| Quality Score: | 6.8 |
| Missing Residues: | 3 |
| Missing Atoms: | 23 |
| DFG conformation: | in |
| αC-helix conformation: | out |
| Salt bridge KIII.17 and EαC.24: | No (16.3Å) |
| ASP rotation (xDFG.81) : | 307° |
| PHE rotation (xDFG.82) : | 324° |
| Activation loop position: | -5Å |
| αC-helix position: | 21.9Å |
| G-rich loop angle: | 48.7° |
| G-rich loop distance: | 14.4Å |
| G-rich loop rotation: | 51.8° |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | EVLGKGCFGQAIKMVMKELTFLKEVKVMRCLEPNVLKFIGVNFITEYIKGGTLRGIIKSYLHSMNIIHRDLNSHNCLVVADFGLA |
| Structure: | EVLGKGCFGQAIKMVMKELTFLKEVKVMRCLEPNVLKFIGVNFITEYIKGGTLRGIIKSYLHSMNIIHRDLNSHNCLVVADF___ |
Modified residues
No modified residues identified.
Orthosteric ligand

Ligand HET-code: 9DB
Ligand Name: (2~{R})-2-azanyl-2-cyclohexyl-~{N}-[2-(1-methylpyrazol-4-yl)-9-oxidanylidene-3,10,11-triazatricyclo[6.4.1.0^{4,13}]trideca-1,4,6,8(13),11-pentaen-6-yl]ethanamide
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
| Main pockets | |
|---|---|
| Front | |
| Gate | |
| Back | |
| Subpockets | |
|---|---|
| FP-I | |
| FP-II | |
| BP-I-A | |
| BP-I-B | |
| BP-II-in | |
| BP-II-A-in | |
| BP-II-B-in | |
| BP-II-out | |
| BP-II-B | |
| BP-III | |
| BP-IV | |
| BP-V | |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
| I | g.l | II | III | αC | |||||||||||||||
| 1 E 343 | 2 V 344 | 3 L 345 | 4 G 346 | 5 K 347 | 6 G 348 | 7 C 349 | 8 F 350 | 9 G 351 | 10 Q 352 | 11 A 353 | 12 I 354 | 13 K 355 | 14 M 365 | 15 V 366 | 16 M 367 | 17 K 368 | 18 E 369 | 19 L 370 | 20 T 380 |
| ■ | ■▲ | ■ | ■ | ■ | ■ | ■ | ■ | ■▲ | |||||||||||
| αC | b.l | IV | |||||||||||||||||
| 21 F 381 | 22 L 382 | 23 K 383 | 24 E 384 | 25 V 385 | 26 K 386 | 27 V 387 | 28 M 388 | 29 R 389 | 30 C 390 | 31 L 391 | 32 E 392 | 33 P 394 | 34 N 395 | 35 V 396 | 36 L 397 | 37 K 398 | 38 F 399 | 39 I 400 | 40 G 401 |
| ■ | |||||||||||||||||||
| IV | V | GK | hinge | linker | αD | αE | |||||||||||||
| 41 V 402 | 42 N 410 | 43 F 411 | 44 I 412 | 45 T 413 | 46 E 414 | 47 Y 415 | 48 I 416 | 49 K 417 | 50 G 418 | 51 G 419 | 52 T 420 | 53 L 421 | 54 R 422 | 55 G 423 | 56 I 424 | 57 I 425 | 58 K 426 | 59 S 427 | 60 Y 450 |
| ▲ | ■ | ■▲ | ■ | ||||||||||||||||
| αE | VI | c.l | VII | VIII | x | ||||||||||||||
| 61 L 451 | 62 H 452 | 63 S 453 | 64 M 454 | 65 N 455 | 66 I 456 | 67 I 457 | 68 H 458 | 69 R 459 | 70 D 460 | 71 L 461 | 72 N 462 | 73 S 463 | 74 H 464 | 75 N 465 | 76 C 466 | 77 L 467 | 78 V 468 | 79 V 476 | 80 A 477 |
| ■ | |||||||||||||||||||
| DFG | a.l | ||||||||||||||||||
| 81 D 478 | 82 F 479 | 83 _ _ | 84 _ _ | 85 _ _ | |||||||||||||||
| ■▲ | |||||||||||||||||||
Binding affinities
ChEMBL ID:CHEMBL3990456Bioaffinities: 17 records for 11 kinase(s)
| Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
|---|---|---|---|---|---|---|
| Homo sapiens | Fibroblast growth factor receptor 3 | 7.6 | 7.6 | 7.6 | pIC50 | 1 |
| Homo sapiens | LIM domain kinase 1 | 6.4 | 6.1 | 6.8 | pIC50 | 3 |
| Homo sapiens | LIM domain kinase 2 | 5.5 | 5.5 | 6.6 | pIC50 | 2 |
| Homo sapiens | Macrophage colony stimulating factor receptor | 8 | 8 | 8 | pIC50 | 1 |
| Homo sapiens | Serine/threonine-protein kinase Aurora-A | 7.6 | 7.6 | 7.6 | pIC50 | 1 |
| Homo sapiens | Serine/threonine-protein kinase Chk1 | 7.4 | 7.4 | 7.4 | pEC50 | 1 |
| Homo sapiens | Serine/threonine-protein kinase Chk1 | 8.3 | 8.3 | 8.3 | pIC50 | 1 |
| Homo sapiens | Serine/threonine-protein kinase Chk1 | 9.3 | 9.3 | 9.3 | pKi | 1 |
| Homo sapiens | Serine/threonine-protein kinase Chk2 | 7.4 | 7.4 | 7.4 | pEC50 | 1 |
| Homo sapiens | Serine/threonine-protein kinase Chk2 | 7.3 | 7.3 | 7.3 | pKi | 1 |
| Homo sapiens | Tyrosine-protein kinase receptor FLT3 | 7.6 | 7.6 | 7.6 | pIC50 | 1 |
| Homo sapiens | Tyrosine-protein kinase receptor RET | 7.4 | 7.4 | 7.4 | pIC50 | 1 |
| Homo sapiens | Tyrosine-protein kinase YES | 7.9 | 7.9 | 7.9 | pIC50 | 1 |
| Homo sapiens | Vascular endothelial growth factor receptor 2 | 8.1 | 8.1 | 8.1 | pIC50 | 1 |