2GS7 - chain A | Epidermal growth factor receptor
Structure information
PDB: | 2GS7 |
PubMed: | 16777603 |
Release date: | 2006-06-20 |
Resolution: | 2.6 Å |
Kinase: | EGFR |
Family: | EGFR |
Group: | TK |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No (13.1Å) |
ASP rotation (xDFG.81) : | 341° |
PHE rotation (xDFG.82) : | 245° |
Activation loop position: | -4.7Å |
αC-helix position: | 21.3Å |
G-rich loop angle: | 52.6° |
G-rich loop distance: | 16Å |
G-rich loop rotation: | 42° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I4
No H-bonds
I6
H-bond ligand
H-bond protein
Binding pocket sequence
Uniprot | KVLGSGAFGTVYKVAIKELEILDEAYVMASVDPHVCRLLGIQLITQLMPFGCLLDYVREYLEDRRLVHRDLAARNVLVITDFGLA |
Structure: | KVLGSGAFGTVYKVAIKELEILDEAYVMASVDPHVCRLLGIQLITQLMPFGCLLDYVREYLEDRRLVHRDLAARNVLVITDFGLA |
Modified residues
No modified residues identified.
Orthosteric ligand
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 K 692 | 2 V 693 | 3 L 694 | 4 G 695 | 5 S 696 | 6 G 697 | 7 A 698 | 8 F 699 | 9 G 700 | 10 T 701 | 11 V 702 | 12 Y 703 | 13 K 704 | 14 V 718 | 15 A 719 | 16 I 720 | 17 K 721 | 18 E 722 | 19 L 723 | 20 E 734 |
■ | ■ | ■ | ■ | ▲ | |||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 I 735 | 22 L 736 | 23 D 737 | 24 E 738 | 25 A 739 | 26 Y 740 | 27 V 741 | 28 M 742 | 29 A 743 | 30 S 744 | 31 V 745 | 32 D 746 | 33 P 748 | 34 H 749 | 35 V 750 | 36 C 751 | 37 R 752 | 38 L 753 | 39 L 754 | 40 G 755 |
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 I 756 | 42 Q 763 | 43 L 764 | 44 I 765 | 45 T 766 | 46 Q 767 | 47 L 768 | 48 M 769 | 49 P 770 | 50 F 771 | 51 G 772 | 52 C 773 | 53 L 774 | 54 L 775 | 55 D 776 | 56 Y 777 | 57 V 778 | 58 R 779 | 59 E 780 | 60 Y 803 |
▲ | ■ | ■▲ | |||||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 804 | 62 E 805 | 63 D 806 | 64 R 807 | 65 R 808 | 66 L 809 | 67 V 810 | 68 H 811 | 69 R 812 | 70 D 813 | 71 L 814 | 72 A 815 | 73 A 816 | 74 R 817 | 75 N 818 | 76 V 819 | 77 L 820 | 78 V 821 | 79 I 829 | 80 T 830 |
■ | |||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 831 | 82 F 832 | 83 G 833 | 84 L 834 | 85 A 835 | |||||||||||||||
Binding affinities
ChEMBL ID:CHEMBL1230989Bioaffinities: No (p)Ki/(p)IC50/(p)EC50 values for kinases found (with a ChEMBL confidence ≥ 8).